- Recombinant Arabidopsis thaliana Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (At1g61280)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1068152
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 15,611 Da
- E Coli or Yeast
- 1-137
- T1F9.23, T1F9_23
- Phosphatidylinositol N-acetylglucosaminyltransferase subunit P (At1g61280)
Sequence
MLSLNQEVHGPKTSEVYGFVGSISIVVATVIFLIWGYVPDKFLESIGIYYYPSKYWAMAMPMYSMVTLLVALVFYIGLNFMSTSKPTSLNTLFDDYSREDVNFLPLMKNGEDRPIDPISDIDITRINDLMFDSHLAK